PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462844481
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 199aa    MW: 22090.3 Da    PI: 10.135
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462844481genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.62.9e-103425899
               EEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
         B3 58 ryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
               + +l++GW eFv a+++ +g f+vF+++   ++ l+vkvf++
  462844481  3 GAFLGRGWPEFVAAHDIGVGWFLVFRHE--GGGMLTVKVFDT 42
               5789**********************65..58889*****97 PP

2B343.94.4e-14781601497
                T-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3  14 grlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                + +v+p  f++++  ++ +++s++ +l ++ g+ W+v+   +k +++ +++++GW++F  +ng+ eg+ ++++++g++ f  +vkvf
  462844481  78 KKMVIPPAFVRNYitELAETNSQMPVLLSLCGKYWRVEA--EKDPSGnVFFSGGWSGFLASNGITEGEALLLRYEGNRVF--TVKVF 160
                459*******999**999999******************..777777699*************************99999..88877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.066143IPR003340B3 DNA binding domain
PfamPF023622.0E-7242IPR003340B3 DNA binding domain
SuperFamilySSF1019361.33E-9245IPR015300DNA-binding pseudobarrel domain
CDDcd100173.38E-8241No hitNo description
Gene3DG3DSA:2.40.330.105.4E-9245IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.9E-1861165IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-1962165IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.32365163IPR003340B3 DNA binding domain
CDDcd100173.89E-1366160No hitNo description
SMARTSM010197.8E-968163IPR003340B3 DNA binding domain
PfamPF023626.1E-1278160IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
GGGAFLGRGW PEFVAAHDIG VGWFLVFRHE GGGMLTVKVF DTSFCLRHFS RPLNVAANGR  60
SRSRRPQFIK PRLPGFMKKM VIPPAFVRNY ITELAETNSQ MPVLLSLCGK YWRVEAEKDP  120
SGNVFFSGGW SGFLASNGIT EGEALLLRYE GNRVFTVKVF GLDGCQKSFG KSTKKMPSGM  180
QQETEQSERT SSVSYLDAF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15866GRSRSRRPQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977888.12e-60PREDICTED: putative B3 domain-containing protein Os04g0347400
SwissprotQ7XS741e-57Y4474_ORYSJ; Putative B3 domain-containing protein Os04g0347400
TrEMBLK3YCY52e-60K3YCY5_SETIT; Uncharacterized protein
STRINGSi012086m6e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.19e-13B3 family protein